Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1258235..1258853 | Replicon | chromosome |
Accession | NZ_CP103673 | ||
Organism | Escherichia coli strain 4069 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M4U10_RS06015 | Protein ID | WP_001291435.1 |
Coordinates | 1258235..1258453 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M4U10_RS06020 | Protein ID | WP_000344800.1 |
Coordinates | 1258479..1258853 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4U10_RS05980 (1253524) | 1253524..1254096 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
M4U10_RS05985 (1254127) | 1254127..1254438 | - | 312 | WP_000409911.1 | MGMT family protein | - |
M4U10_RS05995 (1254817) | 1254817..1255170 | + | 354 | WP_001550741.1 | DUF1428 family protein | - |
M4U10_RS06000 (1255212) | 1255212..1256762 | - | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M4U10_RS06005 (1256926) | 1256926..1257396 | - | 471 | WP_000136192.1 | YlaC family protein | - |
M4U10_RS06010 (1257512) | 1257512..1258063 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M4U10_RS06015 (1258235) | 1258235..1258453 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M4U10_RS06020 (1258479) | 1258479..1258853 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M4U10_RS06025 (1259399) | 1259399..1262548 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
M4U10_RS06030 (1262571) | 1262571..1263764 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256096 WP_001291435.1 NZ_CP103673:c1258453-1258235 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256096 WP_000344800.1 NZ_CP103673:c1258853-1258479 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |