Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4635258..4635853 | Replicon | chromosome |
Accession | NZ_CP103672 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4433 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | M5S92_RS23185 | Protein ID | WP_000239579.1 |
Coordinates | 4635258..4635608 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | M5S92_RS23190 | Protein ID | WP_001223208.1 |
Coordinates | 4635602..4635853 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S92_RS23165 (4630704) | 4630704..4631726 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
M5S92_RS23170 (4631740) | 4631740..4633242 | - | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
M5S92_RS23175 (4633382) | 4633382..4634338 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M5S92_RS23180 (4634648) | 4634648..4635178 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
M5S92_RS23185 (4635258) | 4635258..4635608 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
M5S92_RS23190 (4635602) | 4635602..4635853 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M5S92_RS23195 (4636065) | 4636065..4636406 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M5S92_RS23200 (4636409) | 4636409..4640188 | - | 3780 | WP_135103450.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T256088 WP_000239579.1 NZ_CP103672:c4635608-4635258 [Escherichia coli O25b:H4-ST131]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |