Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4538206..4539041 | Replicon | chromosome |
| Accession | NZ_CP103672 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4433 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5S92_RS22690 | Protein ID | WP_000854759.1 |
| Coordinates | 4538206..4538583 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5S92_RS22695 | Protein ID | WP_001295723.1 |
| Coordinates | 4538673..4539041 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S92_RS22660 (4534144) | 4534144..4534320 | - | 177 | Protein_4450 | helix-turn-helix domain-containing protein | - |
| M5S92_RS22665 (4534512) | 4534512..4535258 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M5S92_RS22670 (4535273) | 4535273..4536814 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M5S92_RS22675 (4537273) | 4537273..4537422 | - | 150 | Protein_4453 | hypothetical protein | - |
| M5S92_RS22680 (4537528) | 4537528..4537704 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5S92_RS22685 (4537721) | 4537721..4538209 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M5S92_RS22690 (4538206) | 4538206..4538583 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5S92_RS22695 (4538673) | 4538673..4539041 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S92_RS22700 (4539204) | 4539204..4539425 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S92_RS22705 (4539488) | 4539488..4539964 | - | 477 | WP_001186775.1 | RadC family protein | - |
| M5S92_RS22710 (4539980) | 4539980..4540453 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| M5S92_RS22715 (4540795) | 4540795..4541613 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| M5S92_RS22720 (4541731) | 4541731..4541926 | - | 196 | Protein_4462 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T256087 WP_000854759.1 NZ_CP103672:c4538583-4538206 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT256087 WP_001295723.1 NZ_CP103672:c4539041-4538673 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |