Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4344828..4345348 Replicon chromosome
Accession NZ_CP103672
Organism Escherichia coli O25b:H4-ST131 strain 4433

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag M5S92_RS21760 Protein ID WP_001160964.1
Coordinates 4344828..4345112 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M5S92_RS21765 Protein ID WP_000125566.1
Coordinates 4345115..4345348 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S92_RS21735 (4340473) 4340473..4341759 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M5S92_RS21740 (4341759) 4341759..4342748 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M5S92_RS21745 (4342745) 4342745..4343566 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M5S92_RS21750 (4343569) 4343569..4343946 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M5S92_RS21755 (4343953) 4343953..4344801 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M5S92_RS21760 (4344828) 4344828..4345112 - 285 WP_001160964.1 CcdB family protein Toxin
M5S92_RS21765 (4345115) 4345115..4345348 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M5S92_RS21770 (4345434) 4345434..4345913 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M5S92_RS21775 (4346105) 4346105..4347967 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
M5S92_RS21780 (4347960) 4347960..4348490 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M5S92_RS21785 (4348598) 4348598..4349929 - 1332 WP_001183209.1 MFS transporter -
M5S92_RS21790 (4349988) 4349988..4350275 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T256085 WP_001160964.1 NZ_CP103672:c4345112-4344828 [Escherichia coli O25b:H4-ST131]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT256085 WP_000125566.1 NZ_CP103672:c4345348-4345115 [Escherichia coli O25b:H4-ST131]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References