Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3893150..3893768 | Replicon | chromosome |
| Accession | NZ_CP103672 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4433 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5S92_RS19605 | Protein ID | WP_001291435.1 |
| Coordinates | 3893550..3893768 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5S92_RS19600 | Protein ID | WP_000344800.1 |
| Coordinates | 3893150..3893524 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S92_RS19590 (3888239) | 3888239..3889432 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5S92_RS19595 (3889455) | 3889455..3892604 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| M5S92_RS19600 (3893150) | 3893150..3893524 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5S92_RS19605 (3893550) | 3893550..3893768 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5S92_RS19610 (3893942) | 3893942..3894493 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| M5S92_RS19615 (3894609) | 3894609..3895079 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M5S92_RS19620 (3895243) | 3895243..3896793 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5S92_RS19625 (3896835) | 3896835..3897188 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| M5S92_RS19635 (3897567) | 3897567..3897878 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| M5S92_RS19640 (3897909) | 3897909..3898481 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256083 WP_001291435.1 NZ_CP103672:3893550-3893768 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256083 WP_000344800.1 NZ_CP103672:3893150-3893524 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |