Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2043288..2044119 Replicon chromosome
Accession NZ_CP103672
Organism Escherichia coli O25b:H4-ST131 strain 4433

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag M5S92_RS09945 Protein ID WP_000854815.1
Coordinates 2043288..2043662 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag M5S92_RS09950 Protein ID WP_001280918.1
Coordinates 2043751..2044119 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S92_RS09905 (2038684) 2038684..2039850 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5S92_RS09910 (2039969) 2039969..2040442 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
M5S92_RS09915 (2040640) 2040640..2041698 + 1059 WP_001200889.1 FUSC family protein -
M5S92_RS09920 (2041870) 2041870..2042199 + 330 WP_000450409.1 DUF496 family protein -
M5S92_RS09925 (2042300) 2042300..2042623 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
M5S92_RS09930 (2042602) 2042602..2042682 + 81 WP_023441679.1 hypothetical protein -
M5S92_RS09935 (2042971) 2042971..2043051 - 81 Protein_1949 hypothetical protein -
M5S92_RS09940 (2043097) 2043097..2043291 - 195 WP_000988600.1 DUF5983 family protein -
M5S92_RS09945 (2043288) 2043288..2043662 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5S92_RS09950 (2043751) 2043751..2044119 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5S92_RS09955 (2044135) 2044135..2044779 - 645 WP_000086752.1 hypothetical protein -
M5S92_RS09960 (2044798) 2044798..2044956 - 159 Protein_1954 DUF987 domain-containing protein -
M5S92_RS09965 (2044922) 2044922..2045473 - 552 Protein_1955 DUF945 domain-containing protein -
M5S92_RS09970 (2045694) 2045694..2046104 - 411 WP_000846703.1 hypothetical protein -
M5S92_RS09975 (2046120) 2046120..2046470 - 351 Protein_1957 hypothetical protein -
M5S92_RS09980 (2046553) 2046553..2047299 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M5S92_RS09985 (2047314) 2047314..2048855 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T256076 WP_000854815.1 NZ_CP103672:c2043662-2043288 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT256076 WP_001280918.1 NZ_CP103672:c2044119-2043751 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References