Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 809757..810591 Replicon chromosome
Accession NZ_CP103672
Organism Escherichia coli O25b:H4-ST131 strain 4433

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag M5S92_RS03950 Protein ID WP_000854690.1
Coordinates 809757..810134 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag M5S92_RS03955 Protein ID WP_001305076.1
Coordinates 810223..810591 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S92_RS03925 (806738) 806738..807671 - 934 Protein_771 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M5S92_RS03930 (807664) 807664..808059 - 396 WP_000208384.1 DUF6088 family protein -
M5S92_RS03935 (808128) 808128..808973 - 846 WP_001529401.1 DUF4942 domain-containing protein -
M5S92_RS03940 (809058) 809058..809255 - 198 WP_000839293.1 DUF957 domain-containing protein -
M5S92_RS03945 (809272) 809272..809760 - 489 WP_000761699.1 DUF5983 family protein -
M5S92_RS03950 (809757) 809757..810134 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
M5S92_RS03955 (810223) 810223..810591 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5S92_RS03960 (810641) 810641..811285 - 645 WP_000094916.1 hypothetical protein -
M5S92_RS03965 (811304) 811304..811525 - 222 WP_000692329.1 DUF987 domain-containing protein -
M5S92_RS03970 (811588) 811588..812064 - 477 WP_001186726.1 RadC family protein -
M5S92_RS03975 (812080) 812080..812565 - 486 WP_000849565.1 antirestriction protein -
M5S92_RS03980 (812620) 812620..813438 - 819 WP_001234620.1 DUF932 domain-containing protein -
M5S92_RS03985 (813539) 813539..813772 - 234 WP_000902034.1 DUF905 family protein -
M5S92_RS03990 (813851) 813851..814306 - 456 WP_000581502.1 IrmA family protein -
M5S92_RS03995 (814382) 814382..815509 - 1128 Protein_785 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T256073 WP_000854690.1 NZ_CP103672:c810134-809757 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT256073 WP_001305076.1 NZ_CP103672:c810591-810223 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References