Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 809757..810591 | Replicon | chromosome |
| Accession | NZ_CP103672 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4433 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | M5S92_RS03950 | Protein ID | WP_000854690.1 |
| Coordinates | 809757..810134 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | M5S92_RS03955 | Protein ID | WP_001305076.1 |
| Coordinates | 810223..810591 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S92_RS03925 (806738) | 806738..807671 | - | 934 | Protein_771 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M5S92_RS03930 (807664) | 807664..808059 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| M5S92_RS03935 (808128) | 808128..808973 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| M5S92_RS03940 (809058) | 809058..809255 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| M5S92_RS03945 (809272) | 809272..809760 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| M5S92_RS03950 (809757) | 809757..810134 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| M5S92_RS03955 (810223) | 810223..810591 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S92_RS03960 (810641) | 810641..811285 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| M5S92_RS03965 (811304) | 811304..811525 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| M5S92_RS03970 (811588) | 811588..812064 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M5S92_RS03975 (812080) | 812080..812565 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| M5S92_RS03980 (812620) | 812620..813438 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M5S92_RS03985 (813539) | 813539..813772 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| M5S92_RS03990 (813851) | 813851..814306 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| M5S92_RS03995 (814382) | 814382..815509 | - | 1128 | Protein_785 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T256073 WP_000854690.1 NZ_CP103672:c810134-809757 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT256073 WP_001305076.1 NZ_CP103672:c810591-810223 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|