Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 63834..64435 Replicon plasmid pMB5646_3
Accession NZ_CP103660
Organism Escherichia coli strain 3150

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag M5R25_RS26480 Protein ID WP_001216047.1
Coordinates 64055..64435 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5R25_RS26475 Protein ID WP_001190712.1
Coordinates 63834..64055 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R25_RS26405 (M5R25_26405) 58910..59128 + 219 WP_001142592.1 DUF4014 family protein -
M5R25_RS26410 (M5R25_26410) 59130..59393 + 264 WP_259430696.1 hypothetical protein -
M5R25_RS26415 (M5R25_26415) 59404..59529 + 126 Protein_66 hypothetical protein -
M5R25_RS26420 (M5R25_26420) 59773..60021 + 249 Protein_67 hypothetical protein -
M5R25_RS26425 (M5R25_26425) 60115..60300 + 186 WP_231532152.1 DUF551 domain-containing protein -
M5R25_RS26430 (M5R25_26430) 60297..60557 + 261 WP_000982275.1 hypothetical protein -
M5R25_RS26435 (M5R25_26435) 60643..60876 + 234 WP_000516537.1 hypothetical protein -
M5R25_RS26440 (M5R25_26440) 61055..61348 + 294 WP_000269004.1 hypothetical protein -
M5R25_RS26445 (M5R25_26445) 61355..61729 + 375 WP_000988656.1 hypothetical protein -
M5R25_RS26450 (M5R25_26450) 61711..62361 + 651 WP_000057451.1 hypothetical protein -
M5R25_RS26455 (M5R25_26455) 62345..62629 + 285 WP_001142394.1 hypothetical protein -
M5R25_RS26460 (M5R25_26460) 62614..62964 - 351 WP_000551789.1 hypothetical protein -
M5R25_RS26465 (M5R25_26465) 62997..63248 + 252 WP_001283837.1 DNA polymerase III subunit theta -
M5R25_RS26470 (M5R25_26470) 63372..63761 + 390 WP_000506726.1 S24 family peptidase -
M5R25_RS26475 (M5R25_26475) 63834..64055 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5R25_RS26480 (M5R25_26480) 64055..64435 + 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5R25_RS26485 (M5R25_26485) 64440..64619 + 180 WP_000113019.1 hypothetical protein -
M5R25_RS26490 (M5R25_26490) 64647..65690 + 1044 WP_063075112.1 DUF968 domain-containing protein -
M5R25_RS26495 (M5R25_26495) 65779..66231 + 453 WP_001312282.1 late promoter-activating protein (Gp10) -
M5R25_RS26500 (M5R25_26500) 66318..67511 + 1194 WP_259430697.1 terminase -
M5R25_RS26505 (M5R25_26505) 67511..68995 + 1485 WP_000124150.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..96232 96232


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T256068 WP_001216047.1 NZ_CP103660:64055-64435 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT256068 WP_001190712.1 NZ_CP103660:63834-64055 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References