Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 33507..34305 | Replicon | plasmid pMB5646_2 |
Accession | NZ_CP103659 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A0K4UCL9 |
Locus tag | M5R25_RS25675 | Protein ID | WP_024173399.1 |
Coordinates | 33784..34305 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | M5R25_RS25670 | Protein ID | WP_001351987.1 |
Coordinates | 33507..33776 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS25645 (M5R25_25645) | 28937..30274 | - | 1338 | WP_228598670.1 | DnaB-like helicase C-terminal domain-containing protein | - |
M5R25_RS25650 (M5R25_25650) | 30318..31058 | - | 741 | WP_053271988.1 | hypothetical protein | - |
M5R25_RS25655 (M5R25_25655) | 31341..32108 | + | 768 | WP_000342417.1 | hypothetical protein | - |
M5R25_RS25660 (M5R25_25660) | 32161..32514 | - | 354 | WP_160378290.1 | hypothetical protein | - |
M5R25_RS25665 (M5R25_25665) | 32520..33188 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
M5R25_RS25670 (M5R25_25670) | 33507..33776 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
M5R25_RS25675 (M5R25_25675) | 33784..34305 | + | 522 | WP_024173399.1 | GNAT family N-acetyltransferase | Toxin |
M5R25_RS25680 (M5R25_25680) | 34473..34724 | - | 252 | WP_001404395.1 | hypothetical protein | - |
M5R25_RS25685 (M5R25_25685) | 34726..35418 | - | 693 | WP_000856757.1 | hypothetical protein | - |
M5R25_RS25690 (M5R25_25690) | 35432..35755 | - | 324 | WP_000064175.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..109579 | 109579 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19475.31 Da Isoelectric Point: 8.6344
>T256067 WP_024173399.1 NZ_CP103659:33784-34305 [Escherichia coli]
VDNIKIEIFSGEKDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEGRPKVLGYYTLSGSCFEKESLPSRSQQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLDFIQLVGNNERSL
FYPTKSIEKLFEE
VDNIKIEIFSGEKDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEGRPKVLGYYTLSGSCFEKESLPSRSQQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLDFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4UCL9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |