Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 108356..108881 | Replicon | plasmid pMB5646_1 |
Accession | NZ_CP103658 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | M5R25_RS25350 | Protein ID | WP_001159868.1 |
Coordinates | 108356..108661 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | M5R25_RS25355 | Protein ID | WP_000813634.1 |
Coordinates | 108663..108881 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS25335 (104266) | 104266..105432 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
M5R25_RS25340 (106020) | 106020..106775 | - | 756 | WP_024946706.1 | replication initiation protein RepE | - |
M5R25_RS25345 (107549) | 107549..108355 | - | 807 | WP_000016982.1 | site-specific integrase | - |
M5R25_RS25350 (108356) | 108356..108661 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M5R25_RS25355 (108663) | 108663..108881 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M5R25_RS25360 (109448) | 109448..109960 | + | 513 | WP_000151784.1 | hypothetical protein | - |
M5R25_RS25365 (109994) | 109994..111127 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
M5R25_RS25370 (111294) | 111294..112067 | - | 774 | WP_000905949.1 | hypothetical protein | - |
M5R25_RS25375 (112080) | 112080..112580 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | catB3 / blaOXA-1 / aac(6')-Ib-cr / aadA5 / qacE / sul1 / mph(A) / erm(B) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..131479 | 131479 | |
- | flank | IS/Tn | sitABCD | - | 112669..117171 | 4502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T256066 WP_001159868.1 NZ_CP103658:c108661-108356 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|