Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5213..5772 Replicon plasmid pMB5646_1
Accession NZ_CP103658
Organism Escherichia coli strain 3150

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag M5R25_RS24700 Protein ID WP_000421272.1
Coordinates 5213..5488 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag M5R25_RS24705 Protein ID WP_001387467.1
Coordinates 5488..5772 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R25_RS24665 (1263) 1263..2003 - 741 WP_001066953.1 tyrosine-type recombinase/integrase -
M5R25_RS24670 (2124) 2124..2306 - 183 WP_042344623.1 hypothetical protein -
M5R25_RS24675 (2373) 2373..2662 - 290 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
M5R25_RS24680 (2649) 2649..2917 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
M5R25_RS24685 (3449) 3449..4618 + 1170 WP_001072355.1 hypothetical protein -
M5R25_RS24690 (4651) 4651..4779 + 129 Protein_6 IS481 family transposase -
M5R25_RS24695 (4904) 4904..5107 - 204 Protein_7 hypothetical protein -
M5R25_RS24700 (5213) 5213..5488 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5R25_RS24705 (5488) 5488..5772 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
M5R25_RS24710 (6377) 6377..7129 + 753 WP_000562172.1 IclR family transcriptional regulator -
M5R25_RS24715 (7175) 7175..8140 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
M5R25_RS24720 (8173) 8173..8553 - 381 WP_024946717.1 Rid family detoxifying hydrolase -
M5R25_RS24725 (8578) 8578..9468 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
M5R25_RS24730 (9701) 9701..9895 - 195 WP_000796505.1 hypothetical protein -
M5R25_RS24735 (9869) 9869..10309 + 441 Protein_15 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catB3 / blaOXA-1 / aac(6')-Ib-cr / aadA5 / qacE / sul1 / mph(A) / erm(B) / tet(B) / sitABCD iucA / iucB / iucC / iucD / iutA 1..131479 131479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T256062 WP_000421272.1 NZ_CP103658:c5488-5213 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT256062 WP_001387467.1 NZ_CP103658:c5772-5488 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References