Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4438174..4438769 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | M5R25_RS21435 | Protein ID | WP_000239581.1 |
Coordinates | 4438174..4438524 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | M5R25_RS21440 | Protein ID | WP_001223213.1 |
Coordinates | 4438518..4438769 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS21415 (4433628) | 4433628..4434650 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
M5R25_RS21420 (4434664) | 4434664..4436166 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
M5R25_RS21425 (4436299) | 4436299..4437255 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M5R25_RS21430 (4437565) | 4437565..4438095 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
M5R25_RS21435 (4438174) | 4438174..4438524 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
M5R25_RS21440 (4438518) | 4438518..4438769 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M5R25_RS21445 (4438981) | 4438981..4439322 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M5R25_RS21450 (4439325) | 4439325..4443104 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T256058 WP_000239581.1 NZ_CP103657:c4438524-4438174 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|