Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4218626..4219176 Replicon chromosome
Accession NZ_CP103657
Organism Escherichia coli strain 3150

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M5R25_RS20350 Protein ID WP_001160966.1
Coordinates 4218626..4218940 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag M5R25_RS20355 Protein ID WP_000125568.1
Coordinates 4218943..4219176 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R25_RS20325 (4214301) 4214301..4215587 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M5R25_RS20330 (4215587) 4215587..4216576 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M5R25_RS20335 (4216573) 4216573..4217394 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M5R25_RS20340 (4217397) 4217397..4217774 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M5R25_RS20345 (4217781) 4217781..4218629 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M5R25_RS20350 (4218626) 4218626..4218940 - 315 WP_001160966.1 CcdB family protein Toxin
M5R25_RS20355 (4218943) 4218943..4219176 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M5R25_RS20360 (4219262) 4219262..4219741 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M5R25_RS20365 (4219933) 4219933..4221795 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
M5R25_RS20370 (4221788) 4221788..4222318 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M5R25_RS20375 (4222426) 4222426..4223757 - 1332 WP_001183201.1 MFS transporter -
M5R25_RS20380 (4223815) 4223815..4224102 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T256056 WP_001160966.1 NZ_CP103657:c4218940-4218626 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT256056 WP_000125568.1 NZ_CP103657:c4219176-4218943 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References