Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3343143..3343848 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5R25_RS16115 | Protein ID | WP_000539521.1 |
Coordinates | 3343143..3343529 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5R25_RS16120 | Protein ID | WP_001280945.1 |
Coordinates | 3343519..3343848 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS16095 (3339147) | 3339147..3339773 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
M5R25_RS16100 (3339770) | 3339770..3340885 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
M5R25_RS16105 (3340996) | 3340996..3341379 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5R25_RS16110 (3341592) | 3341592..3342917 | + | 1326 | WP_129666835.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5R25_RS16115 (3343143) | 3343143..3343529 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R25_RS16120 (3343519) | 3343519..3343848 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5R25_RS16125 (3343918) | 3343918..3345246 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
M5R25_RS16130 (3345254) | 3345254..3347602 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
M5R25_RS16135 (3347779) | 3347779..3348690 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T256052 WP_000539521.1 NZ_CP103657:3343143-3343529 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|