Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3042620..3043404 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | M5R25_RS14625 | Protein ID | WP_000613626.1 |
Coordinates | 3042910..3043404 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A0A1AEM7 |
Locus tag | M5R25_RS14620 | Protein ID | WP_024946541.1 |
Coordinates | 3042620..3042913 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS14610 (3037781) | 3037781..3038740 | - | 960 | WP_022645527.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
M5R25_RS14615 (3039313) | 3039313..3042486 | + | 3174 | WP_022645526.1 | ribonuclease E | - |
M5R25_RS14620 (3042620) | 3042620..3042913 | + | 294 | WP_024946541.1 | DUF1778 domain-containing protein | Antitoxin |
M5R25_RS14625 (3042910) | 3042910..3043404 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
M5R25_RS14630 (3043499) | 3043499..3044452 | - | 954 | WP_022645524.1 | flagellar hook-associated protein FlgL | - |
M5R25_RS14635 (3044464) | 3044464..3046107 | - | 1644 | WP_022645523.1 | flagellar hook-associated protein FlgK | - |
M5R25_RS14640 (3046173) | 3046173..3047114 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
M5R25_RS14645 (3047114) | 3047114..3048211 | - | 1098 | WP_022645522.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T256051 WP_000613626.1 NZ_CP103657:3042910-3043404 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AEM7 |