Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2638486..2639124 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | M5R25_RS12600 | Protein ID | WP_000813794.1 |
Coordinates | 2638948..2639124 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5R25_RS12595 | Protein ID | WP_001270286.1 |
Coordinates | 2638486..2638902 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS12575 (2633638) | 2633638..2634579 | - | 942 | WP_022645667.1 | ABC transporter permease | - |
M5R25_RS12580 (2634580) | 2634580..2635593 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
M5R25_RS12585 (2635611) | 2635611..2636756 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
M5R25_RS12590 (2637001) | 2637001..2638407 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
M5R25_RS12595 (2638486) | 2638486..2638902 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5R25_RS12600 (2638948) | 2638948..2639124 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5R25_RS12605 (2639346) | 2639346..2639576 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
M5R25_RS12610 (2639668) | 2639668..2641629 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5R25_RS12615 (2641702) | 2641702..2642238 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
M5R25_RS12620 (2642330) | 2642330..2643502 | + | 1173 | WP_022645663.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256050 WP_000813794.1 NZ_CP103657:c2639124-2638948 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256050 WP_001270286.1 NZ_CP103657:c2638902-2638486 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|