Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1018326..1018980 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | M5R25_RS04885 | Protein ID | WP_000244781.1 |
Coordinates | 1018573..1018980 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0V9GG32 |
Locus tag | M5R25_RS04880 | Protein ID | WP_001564007.1 |
Coordinates | 1018326..1018592 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS04860 (1014414) | 1014414..1015847 | - | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
M5R25_RS04865 (1015892) | 1015892..1016203 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
M5R25_RS04870 (1016367) | 1016367..1017026 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M5R25_RS04875 (1017103) | 1017103..1018083 | - | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
M5R25_RS04880 (1018326) | 1018326..1018592 | + | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
M5R25_RS04885 (1018573) | 1018573..1018980 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
M5R25_RS04890 (1019020) | 1019020..1019541 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
M5R25_RS04895 (1019653) | 1019653..1020549 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M5R25_RS04900 (1020574) | 1020574..1021284 | + | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5R25_RS04905 (1021290) | 1021290..1023023 | + | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T256043 WP_000244781.1 NZ_CP103657:1018573-1018980 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9GG32 |