Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 870293..871125 Replicon chromosome
Accession NZ_CP103657
Organism Escherichia coli strain 3150

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6G4K9Y9
Locus tag M5R25_RS04100 Protein ID WP_032333762.1
Coordinates 870293..870667 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NQ68
Locus tag M5R25_RS04105 Protein ID WP_001540478.1
Coordinates 870757..871125 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R25_RS04070 (865406) 865406..866554 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
M5R25_RS04075 (866626) 866626..867609 - 984 WP_024946586.1 KpsF/GutQ family sugar-phosphate isomerase -
M5R25_RS04080 (868420) 868420..868590 - 171 Protein_802 IS110 family transposase -
M5R25_RS04085 (868933) 868933..869502 - 570 WP_001560692.1 DUF4942 domain-containing protein -
M5R25_RS04090 (869599) 869599..869796 - 198 WP_000839281.1 DUF957 domain-containing protein -
M5R25_RS04095 (869808) 869808..870296 - 489 WP_000777545.1 DUF5983 family protein -
M5R25_RS04100 (870293) 870293..870667 - 375 WP_032333762.1 TA system toxin CbtA family protein Toxin
M5R25_RS04105 (870757) 870757..871125 - 369 WP_001540478.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5R25_RS04110 (871288) 871288..871509 - 222 WP_000692311.1 DUF987 domain-containing protein -
M5R25_RS04115 (871572) 871572..872048 - 477 WP_001186786.1 RadC family protein -
M5R25_RS04120 (872064) 872064..872549 - 486 WP_000214398.1 antirestriction protein -
M5R25_RS04125 (872640) 872640..873458 - 819 WP_001773857.1 DUF932 domain-containing protein -
M5R25_RS04130 (873548) 873548..873781 - 234 WP_001278283.1 DUF905 family protein -
M5R25_RS04135 (873787) 873787..874464 - 678 WP_001097301.1 hypothetical protein -
M5R25_RS04140 (874612) 874612..875292 - 681 WP_032333197.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 868806..942258 73452


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14017.06 Da        Isoelectric Point: 8.2905

>T256042 WP_032333762.1 NZ_CP103657:c870667-870293 [Escherichia coli]
MKTLPDIHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13652.53 Da        Isoelectric Point: 7.8398

>AT256042 WP_001540478.1 NZ_CP103657:c871125-870757 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6G4K9Y9

Antitoxin

Source ID Structure
AlphaFold DB S1NQ68

References