Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 5785..6310 | Replicon | plasmid pMB5730_1 |
Accession | NZ_CP103655 | ||
Organism | Klebsiella pneumoniae strain 1159 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | W8UQV6 |
Locus tag | M5S75_RS26050 | Protein ID | WP_001568026.1 |
Coordinates | 5785..6090 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | M5S75_RS26055 | Protein ID | WP_001568025.1 |
Coordinates | 6092..6310 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S75_RS26020 (M5S75_26020) | 1501..2127 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
M5S75_RS26025 (M5S75_26025) | 2124..2426 | + | 303 | WP_004197636.1 | hypothetical protein | - |
M5S75_RS26030 (M5S75_26030) | 2866..3660 | - | 795 | WP_004197635.1 | site-specific integrase | - |
M5S75_RS26035 (M5S75_26035) | 3858..4874 | - | 1017 | WP_020315256.1 | hypothetical protein | - |
M5S75_RS26040 (M5S75_26040) | 4871..5194 | - | 324 | WP_022644730.1 | hypothetical protein | - |
M5S75_RS26045 (M5S75_26045) | 5221..5616 | - | 396 | WP_017899885.1 | hypothetical protein | - |
M5S75_RS26050 (M5S75_26050) | 5785..6090 | - | 306 | WP_001568026.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M5S75_RS26055 (M5S75_26055) | 6092..6310 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M5S75_RS26060 (M5S75_26060) | 6971..7675 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
M5S75_RS26065 (M5S75_26065) | 7730..10264 | + | 2535 | Protein_10 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / catA2 / dfrA14 | - | 1..75285 | 75285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11645.32 Da Isoelectric Point: 5.6919
>T256039 WP_001568026.1 NZ_CP103655:c6090-5785 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EZN1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |