Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4795213..4795729 | Replicon | chromosome |
| Accession | NZ_CP103654 | ||
| Organism | Klebsiella pneumoniae strain 1159 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5S75_RS23335 | Protein ID | WP_004178374.1 |
| Coordinates | 4795213..4795497 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | M5S75_RS23340 | Protein ID | WP_032434351.1 |
| Coordinates | 4795487..4795729 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S75_RS23310 (4790696) | 4790696..4790959 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| M5S75_RS23315 (4791089) | 4791089..4791262 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| M5S75_RS23320 (4791265) | 4791265..4792008 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5S75_RS23325 (4792365) | 4792365..4794503 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5S75_RS23330 (4794745) | 4794745..4795209 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5S75_RS23335 (4795213) | 4795213..4795497 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S75_RS23340 (4795487) | 4795487..4795729 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5S75_RS23345 (4795807) | 4795807..4797717 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M5S75_RS23350 (4797740) | 4797740..4798894 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| M5S75_RS23355 (4798960) | 4798960..4799700 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T256036 WP_004178374.1 NZ_CP103654:c4795497-4795213 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|