Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4438612..4439413 Replicon chromosome
Accession NZ_CP103645
Organism Escherichia coli strain 961

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag M5R18_RS21570 Protein ID WP_001094436.1
Coordinates 4439036..4439413 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag M5R18_RS21565 Protein ID WP_015953067.1
Coordinates 4438612..4438989 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R18_RS21530 (4434524) 4434524..4435204 + 681 WP_001282927.1 WYL domain-containing protein -
M5R18_RS21535 (4435352) 4435352..4436029 + 678 WP_001097312.1 hypothetical protein -
M5R18_RS21540 (4436035) 4436035..4436268 + 234 WP_001278287.1 DUF905 family protein -
M5R18_RS21545 (4436358) 4436358..4437176 + 819 WP_001175142.1 DUF932 domain-containing protein -
M5R18_RS21550 (4437267) 4437267..4437752 + 486 WP_000860054.1 antirestriction protein -
M5R18_RS21555 (4437767) 4437767..4438243 + 477 WP_001186756.1 RadC family protein -
M5R18_RS21560 (4438312) 4438312..4438533 + 222 WP_000692312.1 DUF987 domain-containing protein -
M5R18_RS21565 (4438612) 4438612..4438989 + 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5R18_RS21570 (4439036) 4439036..4439413 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
M5R18_RS21575 (4439410) 4439410..4439898 + 489 WP_000761714.1 DUF5983 family protein -
M5R18_RS21580 (4439910) 4439910..4440107 + 198 WP_000839254.1 DUF957 domain-containing protein -
M5R18_RS21585 (4440192) 4440192..4440902 + 711 WP_001621817.1 DUF4942 domain-containing protein -
M5R18_RS21590 (4440951) 4440951..4441706 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
M5R18_RS21595 (4441703) 4441703..4443202 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
M5R18_RS21600 (4443293) 4443293..4443454 + 162 Protein_4221 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T256013 WP_001094436.1 NZ_CP103645:4439036-4439413 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT256013 WP_015953067.1 NZ_CP103645:4438612-4438989 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References