Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3575544..3576162 | Replicon | chromosome |
| Accession | NZ_CP103645 | ||
| Organism | Escherichia coli strain 961 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5R18_RS17330 | Protein ID | WP_001291435.1 |
| Coordinates | 3575944..3576162 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5R18_RS17325 | Protein ID | WP_000344800.1 |
| Coordinates | 3575544..3575918 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R18_RS17315 (3570633) | 3570633..3571826 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5R18_RS17320 (3571849) | 3571849..3574998 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| M5R18_RS17325 (3575544) | 3575544..3575918 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5R18_RS17330 (3575944) | 3575944..3576162 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5R18_RS17335 (3576334) | 3576334..3576885 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| M5R18_RS17340 (3577001) | 3577001..3577471 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M5R18_RS17345 (3577635) | 3577635..3579185 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5R18_RS17350 (3579227) | 3579227..3579580 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| M5R18_RS17360 (3579959) | 3579959..3580270 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| M5R18_RS17365 (3580301) | 3580301..3580873 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256008 WP_001291435.1 NZ_CP103645:3575944-3576162 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256008 WP_000344800.1 NZ_CP103645:3575544-3575918 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |