Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3067328..3068172 | Replicon | chromosome |
Accession | NZ_CP103645 | ||
Organism | Escherichia coli strain 961 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | M5R18_RS14935 | Protein ID | WP_000854686.1 |
Coordinates | 3067328..3067711 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
Locus tag | M5R18_RS14940 | Protein ID | WP_001285602.1 |
Coordinates | 3067792..3068172 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R18_RS14905 (3064005) | 3064005..3064709 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
M5R18_RS14910 (3064994) | 3064994..3065212 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
M5R18_RS14920 (3065703) | 3065703..3066544 | - | 842 | Protein_2918 | DUF4942 domain-containing protein | - |
M5R18_RS14925 (3066629) | 3066629..3066826 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
M5R18_RS14930 (3066843) | 3066843..3067331 | - | 489 | WP_032180032.1 | DUF5983 family protein | - |
M5R18_RS14935 (3067328) | 3067328..3067711 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
M5R18_RS14940 (3067792) | 3067792..3068172 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5R18_RS14945 (3068183) | 3068183..3068866 | - | 684 | WP_000086768.1 | hypothetical protein | - |
M5R18_RS14950 (3068885) | 3068885..3069106 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
M5R18_RS14955 (3069169) | 3069169..3069645 | - | 477 | WP_001186726.1 | RadC family protein | - |
M5R18_RS14960 (3069661) | 3069661..3070146 | - | 486 | WP_000214307.1 | antirestriction protein | - |
M5R18_RS14965 (3070238) | 3070238..3071059 | - | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
M5R18_RS14970 (3071160) | 3071160..3071368 | - | 209 | Protein_2928 | DUF905 domain-containing protein | - |
M5R18_RS14975 (3071469) | 3071469..3071924 | - | 456 | WP_000581506.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T256006 WP_000854686.1 NZ_CP103645:c3067711-3067328 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT256006 WP_001285602.1 NZ_CP103645:c3068172-3067792 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|