Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2475504..2476142 | Replicon | chromosome |
Accession | NZ_CP103645 | ||
Organism | Escherichia coli strain 961 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | M5R18_RS11990 | Protein ID | WP_001447010.1 |
Coordinates | 2475966..2476142 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5R18_RS11985 | Protein ID | WP_001270286.1 |
Coordinates | 2475504..2475920 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R18_RS11965 (2470656) | 2470656..2471597 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M5R18_RS11970 (2471598) | 2471598..2472611 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M5R18_RS11975 (2472629) | 2472629..2473774 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M5R18_RS11980 (2474019) | 2474019..2475425 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M5R18_RS11985 (2475504) | 2475504..2475920 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5R18_RS11990 (2475966) | 2475966..2476142 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5R18_RS11995 (2476364) | 2476364..2476594 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M5R18_RS12000 (2476686) | 2476686..2478647 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5R18_RS12005 (2478720) | 2478720..2479256 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M5R18_RS12010 (2479309) | 2479309..2480523 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T256005 WP_001447010.1 NZ_CP103645:c2476142-2475966 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256005 WP_001270286.1 NZ_CP103645:c2475920-2475504 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|