Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1860512..1861347 | Replicon | chromosome |
| Accession | NZ_CP103645 | ||
| Organism | Escherichia coli strain 961 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M5R18_RS08960 | Protein ID | WP_106490485.1 |
| Coordinates | 1860512..1860889 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q5I3J0 |
| Locus tag | M5R18_RS08965 | Protein ID | WP_001280951.1 |
| Coordinates | 1860979..1861347 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R18_RS08925 (1856032) | 1856032..1856505 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
| M5R18_RS08930 (1856703) | 1856703..1857761 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
| M5R18_RS08935 (1857933) | 1857933..1858262 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| M5R18_RS08940 (1858363) | 1858363..1858728 | - | 366 | WP_001280454.1 | EutP/PduV family microcompartment system protein | - |
| M5R18_RS08945 (1858999) | 1858999..1859388 | - | 390 | WP_001445118.1 | IS110 family transposase | - |
| M5R18_RS08950 (1860186) | 1860186..1860266 | - | 81 | Protein_1746 | hypothetical protein | - |
| M5R18_RS08955 (1860366) | 1860366..1860515 | - | 150 | Protein_1747 | DUF5983 family protein | - |
| M5R18_RS08960 (1860512) | 1860512..1860889 | - | 378 | WP_106490485.1 | TA system toxin CbtA family protein | Toxin |
| M5R18_RS08965 (1860979) | 1860979..1861347 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R18_RS08970 (1861510) | 1861510..1861731 | - | 222 | WP_000692286.1 | DUF987 domain-containing protein | - |
| M5R18_RS08975 (1861794) | 1861794..1862270 | - | 477 | WP_001186774.1 | RadC family protein | - |
| M5R18_RS08980 (1862286) | 1862286..1862759 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| M5R18_RS08985 (1862844) | 1862844..1863269 | + | 426 | WP_000422741.1 | transposase | - |
| M5R18_RS08990 (1863266) | 1863266..1863616 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5R18_RS08995 (1863647) | 1863647..1865260 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1854716..1855936 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14019.97 Da Isoelectric Point: 6.9572
>T255999 WP_106490485.1 NZ_CP103645:c1860889-1860512 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVHTDQSGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVHTDQSGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13699.56 Da Isoelectric Point: 7.0268
>AT255999 WP_001280951.1 NZ_CP103645:c1861347-1860979 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|