Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 823732..824386 | Replicon | chromosome |
| Accession | NZ_CP103645 | ||
| Organism | Escherichia coli strain 961 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M5R18_RS04045 | Protein ID | WP_000244781.1 |
| Coordinates | 823979..824386 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M5R18_RS04040 | Protein ID | WP_000354046.1 |
| Coordinates | 823732..823998 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R18_RS04020 (819820) | 819820..821253 | - | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
| M5R18_RS04025 (821298) | 821298..821609 | + | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5R18_RS04030 (821773) | 821773..822432 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| M5R18_RS04035 (822509) | 822509..823489 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| M5R18_RS04040 (823732) | 823732..823998 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M5R18_RS04045 (823979) | 823979..824386 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M5R18_RS04050 (824426) | 824426..824947 | - | 522 | WP_001521233.1 | flavodoxin FldB | - |
| M5R18_RS04055 (825059) | 825059..825955 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M5R18_RS04060 (825980) | 825980..826690 | + | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5R18_RS04065 (826696) | 826696..828429 | + | 1734 | WP_021523238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T255995 WP_000244781.1 NZ_CP103645:823979-824386 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|