Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 34367..35106 | Replicon | plasmid pMB5921_1 |
Accession | NZ_CP103643 | ||
Organism | Enterobacter hormaechei strain 4453 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A9E6WPH7 |
Locus tag | M5S55_RS23200 | Protein ID | WP_013087269.1 |
Coordinates | 34621..35106 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A9E6WPN8 |
Locus tag | M5S55_RS23195 | Protein ID | WP_007869691.1 |
Coordinates | 34367..34633 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S55_RS23175 (M5S55_23175) | 29922..30692 | + | 771 | WP_047721744.1 | TraX family protein | - |
M5S55_RS23180 (M5S55_23180) | 30707..31030 | + | 324 | WP_015572034.1 | hypothetical protein | - |
M5S55_RS23185 (M5S55_23185) | 31008..31811 | - | 804 | WP_032670854.1 | DUF4225 domain-containing protein | - |
M5S55_RS23190 (M5S55_23190) | 32701..33714 | - | 1014 | WP_045418235.1 | plasmid replication initiator RepA | - |
M5S55_RS23195 (M5S55_23195) | 34367..34633 | + | 267 | WP_007869691.1 | DUF1778 domain-containing protein | Antitoxin |
M5S55_RS23200 (M5S55_23200) | 34621..35106 | + | 486 | WP_013087269.1 | GNAT family N-acetyltransferase | Toxin |
M5S55_RS23205 (M5S55_23205) | 35280..36683 | + | 1404 | WP_000125668.1 | ISNCY family transposase | - |
M5S55_RS23210 (M5S55_23210) | 36716..37420 | - | 705 | WP_000130816.1 | arsenical resistance protein ArsH | - |
M5S55_RS23215 (M5S55_23215) | 37507..37827 | + | 321 | WP_000941305.1 | transcriptional regulator | - |
M5S55_RS23220 (M5S55_23220) | 37873..39162 | + | 1290 | WP_000922628.1 | arsenic transporter | - |
M5S55_RS23225 (M5S55_23225) | 39175..39600 | + | 426 | WP_000065802.1 | glutaredoxin-dependent arsenate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mcr-9 / aph(6)-Id / aph(3'')-Ib / dfrA19 / sul1 / qnrA1 / blaSHV-12 | mrkB / mrkC / mrkD / mrkF / mrkJ | 1..188203 | 188203 | |
- | flank | IS/Tn | - | - | 35280..36683 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17736.45 Da Isoelectric Point: 9.5181
>T255992 WP_013087269.1 NZ_CP103643:34621-35106 [Enterobacter hormaechei]
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|