Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 4680116..4680732 | Replicon | chromosome |
Accession | NZ_CP103642 | ||
Organism | Enterobacter hormaechei strain 4453 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5S55_RS22595 | Protein ID | WP_015569913.1 |
Coordinates | 4680116..4680487 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | M5S55_RS22600 | Protein ID | WP_015569912.1 |
Coordinates | 4680490..4680732 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S55_RS22580 (M5S55_22580) | 4677616..4678518 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
M5S55_RS22585 (M5S55_22585) | 4678515..4679150 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S55_RS22590 (M5S55_22590) | 4679147..4680076 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
M5S55_RS22595 (M5S55_22595) | 4680116..4680487 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
M5S55_RS22600 (M5S55_22600) | 4680490..4680732 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M5S55_RS22605 (M5S55_22605) | 4680931..4681851 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
M5S55_RS22610 (M5S55_22610) | 4681860..4682801 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
M5S55_RS22615 (M5S55_22615) | 4682846..4683283 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
M5S55_RS22620 (M5S55_22620) | 4683280..4684161 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
M5S55_RS22625 (M5S55_22625) | 4684155..4684754 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
M5S55_RS22630 (M5S55_22630) | 4684873..4685673 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T255991 WP_015569913.1 NZ_CP103642:c4680487-4680116 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|