Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3800283..3800940 | Replicon | chromosome |
Accession | NZ_CP103642 | ||
Organism | Enterobacter hormaechei strain 4453 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | M5S55_RS18360 | Protein ID | WP_017382887.1 |
Coordinates | 3800283..3800693 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | M5S55_RS18365 | Protein ID | WP_003863437.1 |
Coordinates | 3800674..3800940 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S55_RS18340 (M5S55_18340) | 3796281..3798014 | - | 1734 | WP_023304383.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M5S55_RS18345 (M5S55_18345) | 3798020..3798733 | - | 714 | WP_023304384.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5S55_RS18350 (M5S55_18350) | 3798762..3799658 | - | 897 | WP_023304385.1 | site-specific tyrosine recombinase XerD | - |
M5S55_RS18355 (M5S55_18355) | 3799760..3800281 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
M5S55_RS18360 (M5S55_18360) | 3800283..3800693 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
M5S55_RS18365 (M5S55_18365) | 3800674..3800940 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
M5S55_RS18370 (M5S55_18370) | 3801235..3802215 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
M5S55_RS18375 (M5S55_18375) | 3802327..3802986 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
M5S55_RS18380 (M5S55_18380) | 3803253..3803984 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
M5S55_RS18385 (M5S55_18385) | 3804101..3805534 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T255990 WP_017382887.1 NZ_CP103642:c3800693-3800283 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |