Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2446215..2446741 | Replicon | chromosome |
| Accession | NZ_CP103642 | ||
| Organism | Enterobacter hormaechei strain 4453 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M5S55_RS11880 | Protein ID | WP_000323025.1 |
| Coordinates | 2446215..2446502 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M5S55_RS11885 | Protein ID | WP_000534858.1 |
| Coordinates | 2446502..2446741 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S55_RS11850 (M5S55_11850) | 2441785..2441961 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| M5S55_RS11855 (M5S55_11855) | 2442472..2443416 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| M5S55_RS11860 (M5S55_11860) | 2443515..2444114 | + | 600 | WP_004248816.1 | hypothetical protein | - |
| M5S55_RS11865 (M5S55_11865) | 2444174..2444524 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| M5S55_RS11870 (M5S55_11870) | 2445056..2445376 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| M5S55_RS11875 (M5S55_11875) | 2445989..2446114 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
| M5S55_RS11880 (M5S55_11880) | 2446215..2446502 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M5S55_RS11885 (M5S55_11885) | 2446502..2446741 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M5S55_RS11890 (M5S55_11890) | 2446766..2446870 | + | 105 | Protein_2323 | hypothetical protein | - |
| M5S55_RS11895 (M5S55_11895) | 2447004..2447927 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| M5S55_RS11900 (M5S55_11900) | 2448127..2448699 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| M5S55_RS11905 (M5S55_11905) | 2449175..2450413 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | clpV/tssH / vipB/tssC / vipA/tssB | 2358767..2477636 | 118869 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T255984 WP_000323025.1 NZ_CP103642:c2446502-2446215 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|