Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1176841..1177461 | Replicon | chromosome |
Accession | NZ_CP103642 | ||
Organism | Enterobacter hormaechei strain 4453 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | M5S55_RS05630 | Protein ID | WP_015571250.1 |
Coordinates | 1176841..1177059 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | M5S55_RS05635 | Protein ID | WP_006809850.1 |
Coordinates | 1177087..1177461 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S55_RS05600 (M5S55_05600) | 1172853..1173113 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
M5S55_RS05605 (M5S55_05605) | 1173116..1173256 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
M5S55_RS05610 (M5S55_05610) | 1173253..1173963 | - | 711 | WP_023303201.1 | GNAT family protein | - |
M5S55_RS05615 (M5S55_05615) | 1174065..1175525 | + | 1461 | WP_023303202.1 | PLP-dependent aminotransferase family protein | - |
M5S55_RS05620 (M5S55_05620) | 1175497..1175964 | - | 468 | WP_017383209.1 | YlaC family protein | - |
M5S55_RS05625 (M5S55_05625) | 1176081..1176632 | - | 552 | WP_023303203.1 | maltose O-acetyltransferase | - |
M5S55_RS05630 (M5S55_05630) | 1176841..1177059 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
M5S55_RS05635 (M5S55_05635) | 1177087..1177461 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
M5S55_RS05640 (M5S55_05640) | 1177972..1181118 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M5S55_RS05645 (M5S55_05645) | 1181141..1182334 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T255983 WP_015571250.1 NZ_CP103642:c1177059-1176841 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT255983 WP_006809850.1 NZ_CP103642:c1177461-1177087 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |