Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1021818..1022533 | Replicon | chromosome |
Accession | NZ_CP103642 | ||
Organism | Enterobacter hormaechei strain 4453 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A8I0UM05 |
Locus tag | M5S55_RS04875 | Protein ID | WP_023303149.1 |
Coordinates | 1022165..1022533 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A8I0UJV2 |
Locus tag | M5S55_RS04870 | Protein ID | WP_023303148.1 |
Coordinates | 1021818..1022144 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S55_RS04845 (M5S55_04845) | 1016852..1018117 | + | 1266 | WP_023303143.1 | hypothetical protein | - |
M5S55_RS04850 (M5S55_04850) | 1018426..1018860 | + | 435 | WP_023303144.1 | hypothetical protein | - |
M5S55_RS04855 (M5S55_04855) | 1018919..1019758 | + | 840 | WP_023303145.1 | hypothetical protein | - |
M5S55_RS04860 (M5S55_04860) | 1020448..1021269 | + | 822 | WP_023303146.1 | DUF932 domain-containing protein | - |
M5S55_RS04865 (M5S55_04865) | 1021335..1021805 | + | 471 | WP_023303147.1 | DNA repair protein RadC | - |
M5S55_RS04870 (M5S55_04870) | 1021818..1022144 | + | 327 | WP_023303148.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5S55_RS04875 (M5S55_04875) | 1022165..1022533 | + | 369 | WP_023303149.1 | TA system toxin CbtA family protein | Toxin |
M5S55_RS04880 (M5S55_04880) | 1022599..1022778 | + | 180 | WP_050582484.1 | hypothetical protein | - |
M5S55_RS04885 (M5S55_04885) | 1023299..1023457 | + | 159 | WP_023303150.1 | hypothetical protein | - |
M5S55_RS04890 (M5S55_04890) | 1023615..1023857 | + | 243 | WP_023303151.1 | hypothetical protein | - |
M5S55_RS04895 (M5S55_04895) | 1023879..1024052 | - | 174 | WP_223862021.1 | YecR family lipoprotein | - |
M5S55_RS04900 (M5S55_04900) | 1024344..1024700 | + | 357 | WP_045608302.1 | hypothetical protein | - |
M5S55_RS04905 (M5S55_04905) | 1024788..1025348 | - | 561 | WP_023303153.1 | tyrosine-type recombinase/integrase | - |
M5S55_RS04910 (M5S55_04910) | 1026861..1027037 | + | 177 | WP_013098603.1 | hypothetical protein | - |
M5S55_RS04915 (M5S55_04915) | 1027034..1027192 | + | 159 | WP_023303154.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1000900..1041208 | 40308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13727.91 Da Isoelectric Point: 8.2822
>T255982 WP_023303149.1 NZ_CP103642:1022165-1022533 [Enterobacter hormaechei]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|