Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 4695907..4696604 | Replicon | chromosome |
| Accession | NZ_CP103639 | ||
| Organism | Klebsiella aerogenes strain 722 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | M5T48_RS22430 | Protein ID | WP_047052163.1 |
| Coordinates | 4695907..4696227 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | M5T48_RS22435 | Protein ID | WP_047052161.1 |
| Coordinates | 4696248..4696604 (-) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T48_RS22405 (M5T48_22405) | 4691548..4692180 | - | 633 | WP_047052165.1 | HNH endonuclease | - |
| M5T48_RS22410 (M5T48_22410) | 4692360..4693229 | + | 870 | WP_015368498.1 | HNH endonuclease | - |
| M5T48_RS22415 (M5T48_22415) | 4693270..4693605 | - | 336 | WP_071647649.1 | hypothetical protein | - |
| M5T48_RS22420 (M5T48_22420) | 4693602..4694159 | - | 558 | WP_045368387.1 | hypothetical protein | - |
| M5T48_RS22425 (M5T48_22425) | 4695272..4695799 | + | 528 | WP_126003110.1 | hypothetical protein | - |
| M5T48_RS22430 (M5T48_22430) | 4695907..4696227 | - | 321 | WP_047052163.1 | TA system toxin CbtA family protein | Toxin |
| M5T48_RS22435 (M5T48_22435) | 4696248..4696604 | - | 357 | WP_047052161.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T48_RS22440 (M5T48_22440) | 4696630..4696851 | - | 222 | WP_072057908.1 | DUF987 family protein | - |
| M5T48_RS22445 (M5T48_22445) | 4696848..4697390 | - | 543 | WP_047052159.1 | DNA repair protein RadC | - |
| M5T48_RS22450 (M5T48_22450) | 4697403..4697852 | - | 450 | WP_047052157.1 | antirestriction protein | - |
| M5T48_RS22455 (M5T48_22455) | 4697883..4698704 | - | 822 | WP_047052156.1 | DUF932 domain-containing protein | - |
| M5T48_RS22460 (M5T48_22460) | 4698932..4699138 | - | 207 | WP_227504721.1 | hypothetical protein | - |
| M5T48_RS22465 (M5T48_22465) | 4699173..4699637 | - | 465 | WP_047052155.1 | hypothetical protein | - |
| M5T48_RS22470 (M5T48_22470) | 4699763..4699921 | - | 159 | WP_045413303.1 | hypothetical protein | - |
| M5T48_RS22475 (M5T48_22475) | 4700134..4701021 | - | 888 | WP_047052151.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4693602..4726068 | 32466 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11992.72 Da Isoelectric Point: 6.4544
>T255979 WP_047052163.1 NZ_CP103639:c4696227-4695907 [Klebsiella aerogenes]
MKFLPATNMRAAKPCQSPVTIWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRTDRRGF
NWQEQSPYLQVVDILQARQAIGSSSK
MKFLPATNMRAAKPCQSPVTIWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRTDRRGF
NWQEQSPYLQVVDILQARQAIGSSSK
Download Length: 321 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13175.89 Da Isoelectric Point: 6.6208
>AT255979 WP_047052161.1 NZ_CP103639:c4696604-4696248 [Klebsiella aerogenes]
MNNHSESGTKPENPACQQWGLKRTITPCFGARLVQEGSRVHFLADRAGFNGTFSDEHALRLDQAFPLILKQLELMLTSGE
LSPQHQHCVTLYYNGLTCEADTLGSCGYVYIAIYPTQR
MNNHSESGTKPENPACQQWGLKRTITPCFGARLVQEGSRVHFLADRAGFNGTFSDEHALRLDQAFPLILKQLELMLTSGE
LSPQHQHCVTLYYNGLTCEADTLGSCGYVYIAIYPTQR
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|