Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 840975..841632 | Replicon | chromosome |
| Accession | NZ_CP103639 | ||
| Organism | Klebsiella aerogenes strain 722 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0H3FM52 |
| Locus tag | M5T48_RS04085 | Protein ID | WP_015369792.1 |
| Coordinates | 841222..841632 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0H3FJK6 |
| Locus tag | M5T48_RS04080 | Protein ID | WP_015369791.1 |
| Coordinates | 840975..841241 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T48_RS04055 (M5T48_04055) | 836202..837635 | - | 1434 | WP_015369787.1 | 6-phospho-beta-glucosidase BglA | - |
| M5T48_RS04060 (M5T48_04060) | 837755..838483 | - | 729 | WP_015369788.1 | MurR/RpiR family transcriptional regulator | - |
| M5T48_RS04065 (M5T48_04065) | 838534..838845 | + | 312 | WP_015369789.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T48_RS04070 (M5T48_04070) | 839010..839669 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| M5T48_RS04075 (M5T48_04075) | 839768..840751 | - | 984 | WP_015369790.1 | tRNA-modifying protein YgfZ | - |
| M5T48_RS04080 (M5T48_04080) | 840975..841241 | + | 267 | WP_015369791.1 | FAD assembly factor SdhE | Antitoxin |
| M5T48_RS04085 (M5T48_04085) | 841222..841632 | + | 411 | WP_015369792.1 | protein YgfX | Toxin |
| M5T48_RS04090 (M5T48_04090) | 841640..842161 | - | 522 | WP_015369793.1 | flavodoxin FldB | - |
| M5T48_RS04095 (M5T48_04095) | 842262..843158 | + | 897 | WP_015369794.1 | site-specific tyrosine recombinase XerD | - |
| M5T48_RS04100 (M5T48_04100) | 843181..843894 | + | 714 | WP_015369795.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T48_RS04105 (M5T48_04105) | 843900..845633 | + | 1734 | WP_047051987.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15887.69 Da Isoelectric Point: 10.0200
>T255972 WP_015369792.1 NZ_CP103639:841222-841632 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FM52 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FJK6 |