Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5304200..5304825 | Replicon | chromosome |
Accession | NZ_CP103635 | ||
Organism | Klebsiella pneumoniae strain 3221 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | M5T10_RS25845 | Protein ID | WP_002882817.1 |
Coordinates | 5304200..5304583 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | M5T10_RS25850 | Protein ID | WP_004150355.1 |
Coordinates | 5304583..5304825 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T10_RS25830 (5301566) | 5301566..5302468 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
M5T10_RS25835 (5302465) | 5302465..5303100 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5T10_RS25840 (5303097) | 5303097..5304026 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
M5T10_RS25845 (5304200) | 5304200..5304583 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T10_RS25850 (5304583) | 5304583..5304825 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
M5T10_RS25855 (5305030) | 5305030..5305947 | + | 918 | WP_009484979.1 | alpha/beta hydrolase | - |
M5T10_RS25860 (5305961) | 5305961..5306902 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
M5T10_RS25865 (5306947) | 5306947..5307384 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
M5T10_RS25870 (5307381) | 5307381..5308241 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
M5T10_RS25875 (5308235) | 5308235..5308834 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T255969 WP_002882817.1 NZ_CP103635:c5304583-5304200 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |