Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4819771..4820287 | Replicon | chromosome |
| Accession | NZ_CP103635 | ||
| Organism | Klebsiella pneumoniae strain 3221 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5T10_RS23535 | Protein ID | WP_004178374.1 |
| Coordinates | 4819771..4820055 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | M5T10_RS23540 | Protein ID | WP_032434351.1 |
| Coordinates | 4820045..4820287 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T10_RS23510 (4815254) | 4815254..4815517 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| M5T10_RS23515 (4815647) | 4815647..4815820 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| M5T10_RS23520 (4815823) | 4815823..4816566 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5T10_RS23525 (4816923) | 4816923..4819061 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5T10_RS23530 (4819303) | 4819303..4819767 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5T10_RS23535 (4819771) | 4819771..4820055 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T10_RS23540 (4820045) | 4820045..4820287 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5T10_RS23545 (4820365) | 4820365..4822275 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M5T10_RS23550 (4822298) | 4822298..4823452 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| M5T10_RS23555 (4823518) | 4823518..4824258 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255967 WP_004178374.1 NZ_CP103635:c4820055-4819771 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|