Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4727043..4727746 | Replicon | chromosome |
| Accession | NZ_CP103635 | ||
| Organism | Klebsiella pneumoniae strain 3221 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | M5T10_RS23140 | Protein ID | WP_071994632.1 |
| Coordinates | 4727043..4727384 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | M5T10_RS23145 | Protein ID | WP_032434296.1 |
| Coordinates | 4727405..4727746 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T10_RS23130 (4723358) | 4723358..4724227 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| M5T10_RS23135 (4724818) | 4724818..4726851 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| M5T10_RS23140 (4727043) | 4727043..4727384 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| M5T10_RS23145 (4727405) | 4727405..4727746 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T10_RS23150 (4727757) | 4727757..4728299 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| M5T10_RS23155 (4728312) | 4728312..4728752 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| M5T10_RS23160 (4728783) | 4728783..4729604 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| M5T10_RS23165 (4729724) | 4729724..4730197 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| M5T10_RS23170 (4730269) | 4730269..4730721 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| M5T10_RS23175 (4730757) | 4730757..4731473 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| M5T10_RS23180 (4731717) | 4731717..4732591 | - | 875 | Protein_4542 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4715340..4761013 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T255966 WP_071994632.1 NZ_CP103635:c4727384-4727043 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|