Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4696639..4697474 | Replicon | chromosome |
| Accession | NZ_CP103633 | ||
| Organism | Escherichia coli strain 2900 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J1YPH7 |
| Locus tag | M5S90_RS22685 | Protein ID | WP_029701676.1 |
| Coordinates | 4697097..4697474 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K5N986 |
| Locus tag | M5S90_RS22680 | Protein ID | WP_021553056.1 |
| Coordinates | 4696639..4697007 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S90_RS22645 (4692301) | 4692301..4692981 | + | 681 | WP_029702103.1 | WYL domain-containing protein | - |
| M5S90_RS22650 (4693129) | 4693129..4693806 | + | 678 | WP_001097302.1 | hypothetical protein | - |
| M5S90_RS22655 (4693812) | 4693812..4694045 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| M5S90_RS22660 (4694135) | 4694135..4694953 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| M5S90_RS22665 (4695219) | 4695219..4695698 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| M5S90_RS22670 (4695714) | 4695714..4696190 | + | 477 | WP_021553055.1 | RadC family protein | - |
| M5S90_RS22675 (4696255) | 4696255..4696476 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S90_RS22680 (4696639) | 4696639..4697007 | + | 369 | WP_021553056.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S90_RS22685 (4697097) | 4697097..4697474 | + | 378 | WP_029701676.1 | TA system toxin CbtA family protein | Toxin |
| M5S90_RS22690 (4697471) | 4697471..4697620 | + | 150 | Protein_4441 | DUF5983 family protein | - |
| M5S90_RS22695 (4697699) | 4697699..4697893 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| M5S90_RS22700 (4697978) | 4697978..4698820 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| M5S90_RS22705 (4699569) | 4699569..4701107 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4663137..4708919 | 45782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14066.04 Da Isoelectric Point: 7.8045
>T255945 WP_029701676.1 NZ_CP103633:4697097-4697474 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13615.39 Da Isoelectric Point: 7.0264
>AT255945 WP_021553056.1 NZ_CP103633:4696639-4697007 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1YPH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K5N986 |