Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4535219..4535814 | Replicon | chromosome |
Accession | NZ_CP103633 | ||
Organism | Escherichia coli strain 2900 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | M5S90_RS21800 | Protein ID | WP_000239581.1 |
Coordinates | 4535219..4535569 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | M5S90_RS21805 | Protein ID | WP_001223213.1 |
Coordinates | 4535563..4535814 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S90_RS21780 (4530673) | 4530673..4531695 | - | 1023 | WP_001361374.1 | ABC transporter permease | - |
M5S90_RS21785 (4531709) | 4531709..4533211 | - | 1503 | WP_001522399.1 | sugar ABC transporter ATP-binding protein | - |
M5S90_RS21790 (4533344) | 4533344..4534300 | - | 957 | WP_001522398.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M5S90_RS21795 (4534610) | 4534610..4535140 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
M5S90_RS21800 (4535219) | 4535219..4535569 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
M5S90_RS21805 (4535563) | 4535563..4535814 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M5S90_RS21810 (4536026) | 4536026..4536367 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M5S90_RS21815 (4536370) | 4536370..4540149 | - | 3780 | WP_001522396.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T255944 WP_000239581.1 NZ_CP103633:c4535569-4535219 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|