Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3811080..3811698 | Replicon | chromosome |
Accession | NZ_CP103633 | ||
Organism | Escherichia coli strain 2900 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5S90_RS18345 | Protein ID | WP_001291435.1 |
Coordinates | 3811480..3811698 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5S90_RS18340 | Protein ID | WP_000344800.1 |
Coordinates | 3811080..3811454 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S90_RS18330 (3806169) | 3806169..3807362 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5S90_RS18335 (3807385) | 3807385..3810534 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
M5S90_RS18340 (3811080) | 3811080..3811454 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5S90_RS18345 (3811480) | 3811480..3811698 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5S90_RS18350 (3811870) | 3811870..3812421 | + | 552 | WP_001522034.1 | maltose O-acetyltransferase | - |
M5S90_RS18355 (3812537) | 3812537..3813007 | + | 471 | WP_001490888.1 | YlaC family protein | - |
M5S90_RS18360 (3813171) | 3813171..3814721 | + | 1551 | WP_001577872.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5S90_RS18365 (3814763) | 3814763..3815116 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M5S90_RS18375 (3815495) | 3815495..3815806 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5S90_RS18380 (3815837) | 3815837..3816409 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255939 WP_001291435.1 NZ_CP103633:3811480-3811698 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255939 WP_000344800.1 NZ_CP103633:3811080-3811454 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |