Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3389185..3389890 | Replicon | chromosome |
Accession | NZ_CP103633 | ||
Organism | Escherichia coli strain 2900 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5S90_RS16485 | Protein ID | WP_000539521.1 |
Coordinates | 3389185..3389571 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5S90_RS16490 | Protein ID | WP_001280945.1 |
Coordinates | 3389561..3389890 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S90_RS16465 (3385189) | 3385189..3385815 | + | 627 | WP_020233670.1 | glutathione S-transferase GstB | - |
M5S90_RS16470 (3385812) | 3385812..3386927 | - | 1116 | WP_000555050.1 | aldose sugar dehydrogenase YliI | - |
M5S90_RS16475 (3387038) | 3387038..3387421 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5S90_RS16480 (3387634) | 3387634..3388959 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5S90_RS16485 (3389185) | 3389185..3389571 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S90_RS16490 (3389561) | 3389561..3389890 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5S90_RS16495 (3389960) | 3389960..3391288 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
M5S90_RS16500 (3391296) | 3391296..3393644 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
M5S90_RS16505 (3393822) | 3393822..3394733 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T255938 WP_000539521.1 NZ_CP103633:3389185-3389571 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|