Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2572372..2573010 | Replicon | chromosome |
| Accession | NZ_CP103633 | ||
| Organism | Escherichia coli strain 2900 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0D8WF76 |
| Locus tag | M5S90_RS12330 | Protein ID | WP_001306887.1 |
| Coordinates | 2572372..2572548 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5S90_RS12335 | Protein ID | WP_001270286.1 |
| Coordinates | 2572594..2573010 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S90_RS12305 (2567428) | 2567428..2567886 | + | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| M5S90_RS12310 (2567994) | 2567994..2569166 | - | 1173 | WP_001523225.1 | BenE family transporter YdcO | - |
| M5S90_RS12315 (2569258) | 2569258..2569794 | + | 537 | WP_020233877.1 | DNA-binding transcriptional regulator SutR | - |
| M5S90_RS12320 (2569867) | 2569867..2571828 | + | 1962 | WP_024166512.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5S90_RS12325 (2571920) | 2571920..2572150 | - | 231 | WP_000494241.1 | YncJ family protein | - |
| M5S90_RS12330 (2572372) | 2572372..2572548 | + | 177 | WP_001306887.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5S90_RS12335 (2572594) | 2572594..2573010 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5S90_RS12340 (2573089) | 2573089..2574495 | + | 1407 | WP_001523229.1 | PLP-dependent aminotransferase family protein | - |
| M5S90_RS12345 (2574740) | 2574740..2575885 | + | 1146 | WP_020233879.1 | ABC transporter substrate-binding protein | - |
| M5S90_RS12350 (2575903) | 2575903..2576916 | + | 1014 | WP_001523231.1 | ABC transporter ATP-binding protein | - |
| M5S90_RS12355 (2576917) | 2576917..2577858 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2567428..2567886 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6768.88 Da Isoelectric Point: 11.5336
>T255935 WP_001306887.1 NZ_CP103633:2572372-2572548 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255935 WP_001270286.1 NZ_CP103633:2572594-2573010 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|