Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1230922..1231754 | Replicon | chromosome |
Accession | NZ_CP103633 | ||
Organism | Escherichia coli strain 2900 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | F4TJC5 |
Locus tag | M5S90_RS05875 | Protein ID | WP_001094452.1 |
Coordinates | 1230922..1231296 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | F4TJC4 |
Locus tag | M5S90_RS05880 | Protein ID | WP_001285579.1 |
Coordinates | 1231386..1231754 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S90_RS05850 (1226297) | 1226297..1228549 | - | 2253 | WP_021523230.1 | alpha-amylase family glycosyl hydrolase | - |
M5S90_RS05860 (1229283) | 1229283..1230128 | - | 846 | WP_001290261.1 | DUF4942 domain-containing protein | - |
M5S90_RS05865 (1230225) | 1230225..1230422 | - | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
M5S90_RS05870 (1230434) | 1230434..1230925 | - | 492 | WP_000976868.1 | DUF5983 family protein | - |
M5S90_RS05875 (1230922) | 1230922..1231296 | - | 375 | WP_001094452.1 | TA system toxin CbtA family protein | Toxin |
M5S90_RS05880 (1231386) | 1231386..1231754 | - | 369 | WP_001285579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5S90_RS05885 (1231834) | 1231834..1232055 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
M5S90_RS05890 (1232118) | 1232118..1232594 | - | 477 | WP_001186706.1 | RadC family protein | - |
M5S90_RS05895 (1232610) | 1232610..1233095 | - | 486 | WP_000206669.1 | antirestriction protein | - |
M5S90_RS05900 (1233187) | 1233187..1234004 | - | 818 | Protein_1153 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14014.86 Da Isoelectric Point: 7.2920
>T255928 WP_001094452.1 NZ_CP103633:c1231296-1230922 [Escherichia coli]
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13580.39 Da Isoelectric Point: 7.3223
>AT255928 WP_001285579.1 NZ_CP103633:c1231754-1231386 [Escherichia coli]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7YIM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z8DWX2 |