Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4155216..4156030 | Replicon | chromosome |
Accession | NZ_CP103626 | ||
Organism | Escherichia coli strain 4012 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | M5S78_RS20120 | Protein ID | WP_001054376.1 |
Coordinates | 4155216..4155473 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | M5S78_RS20125 | Protein ID | WP_001309181.1 |
Coordinates | 4155485..4156030 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S78_RS20095 (4150504) | 4150504..4151610 | + | 1107 | WP_023568191.1 | N-acetylneuraminate epimerase | - |
M5S78_RS20100 (4151675) | 4151675..4152655 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
M5S78_RS20105 (4152765) | 4152765..4152970 | + | 206 | Protein_3927 | HNH endonuclease | - |
M5S78_RS20110 (4153238) | 4153238..4154478 | - | 1241 | Protein_3928 | helicase YjhR | - |
M5S78_RS20115 (4154594) | 4154594..4154725 | + | 132 | WP_001309182.1 | hypothetical protein | - |
M5S78_RS20120 (4155216) | 4155216..4155473 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
M5S78_RS20125 (4155485) | 4155485..4156030 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
M5S78_RS20130 (4156086) | 4156086..4156832 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
M5S78_RS20135 (4157001) | 4157001..4157219 | + | 219 | Protein_3933 | hypothetical protein | - |
M5S78_RS20140 (4157257) | 4157257..4157373 | + | 117 | Protein_3934 | VOC family protein | - |
M5S78_RS20145 (4157618) | 4157618..4158739 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
M5S78_RS20150 (4158736) | 4158736..4159014 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
M5S78_RS20155 (4159026) | 4159026..4160339 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4145002..4164254 | 19252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T255907 WP_001054376.1 NZ_CP103626:4155216-4155473 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT255907 WP_001309181.1 NZ_CP103626:4155485-4156030 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|