Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1362707..1363332 | Replicon | chromosome |
| Accession | NZ_CP103626 | ||
| Organism | Escherichia coli strain 4012 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5S78_RS06675 | Protein ID | WP_000911330.1 |
| Coordinates | 1362934..1363332 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | M5S78_RS06670 | Protein ID | WP_000450524.1 |
| Coordinates | 1362707..1362934 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S78_RS06645 (1358510) | 1358510..1358980 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| M5S78_RS06650 (1358980) | 1358980..1359552 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| M5S78_RS06655 (1359698) | 1359698..1360576 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| M5S78_RS06660 (1360593) | 1360593..1361627 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| M5S78_RS06665 (1361840) | 1361840..1362553 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| M5S78_RS06670 (1362707) | 1362707..1362934 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| M5S78_RS06675 (1362934) | 1362934..1363332 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5S78_RS06680 (1363479) | 1363479..1364342 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| M5S78_RS06685 (1364357) | 1364357..1366372 | + | 2016 | WP_069354268.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| M5S78_RS06690 (1366446) | 1366446..1367144 | + | 699 | WP_000679812.1 | esterase | - |
| M5S78_RS06695 (1367254) | 1367254..1367454 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T255899 WP_000911330.1 NZ_CP103626:1362934-1363332 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|