Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4337054..4337852 | Replicon | chromosome |
| Accession | NZ_CP103623 | ||
| Organism | Escherichia coli strain 3985 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | M5T36_RS20970 | Protein ID | WP_000854735.1 |
| Coordinates | 4337475..4337852 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | M5T36_RS20965 | Protein ID | WP_001285415.1 |
| Coordinates | 4337054..4337428 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T36_RS20930 (4332626) | 4332626..4333510 | + | 885 | WP_000010403.1 | 50S ribosome-binding GTPase | - |
| M5T36_RS20935 (4333629) | 4333629..4334306 | + | 678 | WP_001562086.1 | hypothetical protein | - |
| M5T36_RS20940 (4334312) | 4334312..4334545 | + | 234 | WP_089540096.1 | DUF905 family protein | - |
| M5T36_RS20945 (4334635) | 4334635..4335453 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| M5T36_RS20950 (4335719) | 4335719..4336198 | + | 480 | WP_257244951.1 | antirestriction protein | - |
| M5T36_RS20955 (4336214) | 4336214..4336690 | + | 477 | WP_001366855.1 | RadC family protein | - |
| M5T36_RS20960 (4336753) | 4336753..4336974 | + | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| M5T36_RS20965 (4337054) | 4337054..4337428 | + | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T36_RS20970 (4337475) | 4337475..4337852 | + | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| M5T36_RS20975 (4337849) | 4337849..4338337 | + | 489 | WP_000761677.1 | DUF5983 family protein | - |
| M5T36_RS20980 (4338349) | 4338349..4338546 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| M5T36_RS20985 (4338631) | 4338631..4339497 | + | 867 | WP_001280433.1 | DUF4942 domain-containing protein | - |
| M5T36_RS20990 (4339569) | 4339569..4339832 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| M5T36_RS20995 (4339829) | 4339829..4340155 | + | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M5T36_RS21000 (4341038) | 4341038..4342576 | + | 1539 | WP_001187172.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul1 / qacE / ant(3'')-Ia / ant(2'')-Ia / floR / dfrA36 / sul2 | - | 4282722..4350388 | 67666 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T255888 WP_000854735.1 NZ_CP103623:4337475-4337852 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT255888 WP_001285415.1 NZ_CP103623:4337054-4337428 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067H947 |