Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4337054..4337852 Replicon chromosome
Accession NZ_CP103623
Organism Escherichia coli strain 3985

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag M5T36_RS20970 Protein ID WP_000854735.1
Coordinates 4337475..4337852 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag M5T36_RS20965 Protein ID WP_001285415.1
Coordinates 4337054..4337428 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T36_RS20930 (4332626) 4332626..4333510 + 885 WP_000010403.1 50S ribosome-binding GTPase -
M5T36_RS20935 (4333629) 4333629..4334306 + 678 WP_001562086.1 hypothetical protein -
M5T36_RS20940 (4334312) 4334312..4334545 + 234 WP_089540096.1 DUF905 family protein -
M5T36_RS20945 (4334635) 4334635..4335453 + 819 WP_001175165.1 DUF932 domain-containing protein -
M5T36_RS20950 (4335719) 4335719..4336198 + 480 WP_257244951.1 antirestriction protein -
M5T36_RS20955 (4336214) 4336214..4336690 + 477 WP_001366855.1 RadC family protein -
M5T36_RS20960 (4336753) 4336753..4336974 + 222 WP_000692309.1 DUF987 domain-containing protein -
M5T36_RS20965 (4337054) 4337054..4337428 + 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T36_RS20970 (4337475) 4337475..4337852 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
M5T36_RS20975 (4337849) 4337849..4338337 + 489 WP_000761677.1 DUF5983 family protein -
M5T36_RS20980 (4338349) 4338349..4338546 + 198 WP_000839291.1 DUF957 domain-containing protein -
M5T36_RS20985 (4338631) 4338631..4339497 + 867 WP_001280433.1 DUF4942 domain-containing protein -
M5T36_RS20990 (4339569) 4339569..4339832 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
M5T36_RS20995 (4339829) 4339829..4340155 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
M5T36_RS21000 (4341038) 4341038..4342576 + 1539 WP_001187172.1 lysine decarboxylation/transport transcriptional activator CadC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul1 / qacE / ant(3'')-Ia / ant(2'')-Ia / floR / dfrA36 / sul2 - 4282722..4350388 67666


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T255888 WP_000854735.1 NZ_CP103623:4337475-4337852 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT255888 WP_001285415.1 NZ_CP103623:4337054-4337428 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References