Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4187112..4187674 | Replicon | chromosome |
Accession | NZ_CP103623 | ||
Organism | Escherichia coli strain 3985 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | M5T36_RS20180 | Protein ID | WP_053877263.1 |
Coordinates | 4187112..4187429 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | M5T36_RS20185 | Protein ID | WP_001223208.1 |
Coordinates | 4187423..4187674 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T36_RS20160 (4182558) | 4182558..4183580 | - | 1023 | WP_001368084.1 | ABC transporter permease | - |
M5T36_RS20165 (4183594) | 4183594..4185096 | - | 1503 | WP_000210554.1 | sugar ABC transporter ATP-binding protein | - |
M5T36_RS20170 (4185236) | 4185236..4186192 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M5T36_RS20175 (4186502) | 4186502..4187032 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
M5T36_RS20180 (4187112) | 4187112..4187429 | - | 318 | WP_053877263.1 | endoribonuclease toxin ChpB | Toxin |
M5T36_RS20185 (4187423) | 4187423..4187674 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M5T36_RS20190 (4187886) | 4187886..4188227 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M5T36_RS20195 (4188230) | 4188230..4192009 | - | 3780 | WP_000060896.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11289.00 Da Isoelectric Point: 6.2152
>T255887 WP_053877263.1 NZ_CP103623:c4187429-4187112 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|