Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4087950..4088785 Replicon chromosome
Accession NZ_CP103623
Organism Escherichia coli strain 3985

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2S4A272
Locus tag M5T36_RS19665 Protein ID WP_001094443.1
Coordinates 4087950..4088327 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag M5T36_RS19670 Protein ID WP_001285607.1
Coordinates 4088417..4088785 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T36_RS19635 (4083081) 4083081..4083623 + 543 WP_001115385.1 hypothetical protein -
M5T36_RS19640 (4083620) 4083620..4085089 + 1470 WP_001022619.1 serine/threonine-protein kinase -
M5T36_RS19645 (4085290) 4085290..4086555 - 1266 WP_001218329.1 integrase arm-type DNA-binding domain-containing protein -
M5T36_RS19650 (4087020) 4087020..4087163 - 144 Protein_3843 hypothetical protein -
M5T36_RS19655 (4087248) 4087248..4087445 - 198 WP_001327226.1 DUF957 domain-containing protein -
M5T36_RS19660 (4087465) 4087465..4087953 - 489 WP_000761685.1 DUF5983 family protein -
M5T36_RS19665 (4087950) 4087950..4088327 - 378 WP_001094443.1 TA system toxin CbtA family protein Toxin
M5T36_RS19670 (4088417) 4088417..4088785 - 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T36_RS19675 (4088865) 4088865..4089086 - 222 WP_000692350.1 DUF987 domain-containing protein -
M5T36_RS19680 (4089173) 4089173..4089649 - 477 WP_001186165.1 RadC family protein -
M5T36_RS19685 (4089664) 4089664..4090149 - 486 WP_000206664.1 antirestriction protein -
M5T36_RS19690 (4090241) 4090241..4091059 - 819 WP_001175163.1 DUF932 domain-containing protein -
M5T36_RS19695 (4091149) 4091149..4091382 - 234 WP_001278287.1 DUF905 family protein -
M5T36_RS19700 (4091388) 4091388..4092065 - 678 WP_001097301.1 hypothetical protein -
M5T36_RS19705 (4092213) 4092213..4092893 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island tet(B) fimC / fimI / fimA / fimE / fimB 4056661..4132616 75955


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14058.97 Da        Isoelectric Point: 7.3523

>T255886 WP_001094443.1 NZ_CP103623:c4088327-4087950 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT255886 WP_001285607.1 NZ_CP103623:c4088785-4088417 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4A272

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References