Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3487132..3487969 | Replicon | chromosome |
Accession | NZ_CP103623 | ||
Organism | Escherichia coli strain 3985 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | M5T36_RS16855 | Protein ID | WP_000227784.1 |
Coordinates | 3487427..3487969 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | M5T36_RS16850 | Protein ID | WP_001297137.1 |
Coordinates | 3487132..3487443 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T36_RS16825 (3482152) | 3482152..3483099 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
M5T36_RS16830 (3483121) | 3483121..3485112 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
M5T36_RS16835 (3485102) | 3485102..3485716 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M5T36_RS16840 (3485716) | 3485716..3486045 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M5T36_RS16845 (3486057) | 3486057..3486947 | + | 891 | WP_000971332.1 | heme o synthase | - |
M5T36_RS16850 (3487132) | 3487132..3487443 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
M5T36_RS16855 (3487427) | 3487427..3487969 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
M5T36_RS16860 (3488025) | 3488025..3488960 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
M5T36_RS16865 (3489368) | 3489368..3490732 | + | 1365 | WP_001000978.1 | MFS transporter | - |
M5T36_RS16870 (3490860) | 3490860..3491351 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
M5T36_RS16875 (3491519) | 3491519..3492430 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T255884 WP_000227784.1 NZ_CP103623:3487427-3487969 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|