Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3453056..3453674 | Replicon | chromosome |
Accession | NZ_CP103623 | ||
Organism | Escherichia coli strain 3985 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5T36_RS16685 | Protein ID | WP_001291435.1 |
Coordinates | 3453456..3453674 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | E9TLB8 |
Locus tag | M5T36_RS16680 | Protein ID | WP_000344794.1 |
Coordinates | 3453056..3453430 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T36_RS16670 (3448145) | 3448145..3449338 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5T36_RS16675 (3449361) | 3449361..3452510 | + | 3150 | WP_001132470.1 | efflux RND transporter permease AcrB | - |
M5T36_RS16680 (3453056) | 3453056..3453430 | + | 375 | WP_000344794.1 | Hha toxicity modulator TomB | Antitoxin |
M5T36_RS16685 (3453456) | 3453456..3453674 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5T36_RS16690 (3453845) | 3453845..3454396 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M5T36_RS16695 (3454512) | 3454512..3454982 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M5T36_RS16700 (3455146) | 3455146..3456696 | + | 1551 | WP_001364591.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5T36_RS16705 (3456738) | 3456738..3457091 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M5T36_RS16715 (3457470) | 3457470..3457781 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5T36_RS16720 (3457812) | 3457812..3458384 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255883 WP_001291435.1 NZ_CP103623:3453456-3453674 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14527.36 Da Isoelectric Point: 4.9284
>AT255883 WP_000344794.1 NZ_CP103623:3453056-3453430 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGRVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGRVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|